PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM09G17630.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 870aa    MW: 91507 Da    PI: 6.0296
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM09G17630.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.22.1e-21122177156
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      +++ +++t++q++eLe++F+++++p++++r eL+++l+L+ rqVk+WFqNrR+++k
  OGLUM09G17630.1 122 KKRYHRHTPQQIQELEAVFKECPHPDEKQRMELSRRLNLESRQVKFWFQNRRTQMK 177
                      688999***********************************************999 PP

2START177.57.8e-563475771205
                      HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEE CS
            START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                      ela++a++elvk a+ +ep+W  s     e +n+de+ + f++  +     + +ea r+sg+ +  +++lv +l+d + +W+e+++    +a+t
  OGLUM09G17630.1 347 ELALAAMDELVKVAQMDEPLWLPSLdggfETLNYDEYHRAFARVVGqcpagYVSEATRESGIAIISSVDLVDSLMDAP-RWSEMFPcvvaRAST 439
                      5899*************************************8866699******************************.*************** PP

                      EEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--........-TTSEE-EESSEEEEEEEECTCE CS
            START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.......sssvvRaellpSgiliepksngh 161
                      ++ issg      g +qlm aelq+lsplvp R++vf+R+++q+ +g w++vdvSvd    p +       sss++ ++llp+g++++++ ng+
  OGLUM09G17630.1 440 TDIISSGmggtrsGSIQLMHAELQVLSPLVPiREVVFLRFCKQHAEGLWAVVDVSVDAVLRPDQnggggssSSSYMGCRLLPTGCIVQDMNNGY 533
                      *********************************************************988877667788889********************** PP

                      EEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
            START 162 skvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                      skvtwv h+++++   h+l+r+l++sg+a ga++w+a lqrqc+
  OGLUM09G17630.1 534 SKVTWVVHAEYDETAAHQLYRPLLRSGQALGARRWLASLQRQCQ 577
                      *******************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.14E-22104179IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-23109179IPR009057Homeodomain-like
PROSITE profilePS5007118.301119179IPR001356Homeobox domain
SMARTSM003891.5E-19120183IPR001356Homeobox domain
PfamPF000466.4E-19122177IPR001356Homeobox domain
CDDcd000861.04E-19122179No hitNo description
PROSITE patternPS000270154177IPR017970Homeobox, conserved site
PROSITE profilePS5084841.927338581IPR002913START domain
SuperFamilySSF559616.92E-30342577No hitNo description
SMARTSM002343.3E-39347578IPR002913START domain
PfamPF018523.9E-47347577IPR002913START domain
CDDcd088757.42E-99353577No hitNo description
SuperFamilySSF559613.85E-14597793No hitNo description
SuperFamilySSF559613.85E-14821852No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 870 aa     Download sequence    Send to blast
MSFGGMFDGA GSGVFSYDAG GGGGGGVHNS RLLPTPPVPK PGGGFAAPGL SLGLQTMDGS  60
QLGDVNRSLA MMGNGGSGSG GDGDSLGRGR EDENDSRSGS DNLDGASGDE LDPDNSNPRK  120
KKKRYHRHTP QQIQELEAVF KECPHPDEKQ RMELSRRLNL ESRQVKFWFQ NRRTQMKTQI  180
ERHENALLRQ ENDKLRAENM TIREAMRNPM CASCGGAAVL GEVSLEEQHL RIENARLKDE  240
LDRVCALAGK FLGRPISSIS SPGPPSLQAC SGLELGVGSN GGFGLGALGA SAAMQSIPDL  300
MGGSSGLTGG PVGSAAMRLP AGIGGLDGAM HAAAADGGAI DRAVLLELAL AAMDELVKVA  360
QMDEPLWLPS LDGGFETLNY DEYHRAFARV VGQCPAGYVS EATRESGIAI ISSVDLVDSL  420
MDAPRWSEMF PCVVARASTT DIISSGMGGT RSGSIQLMHA ELQVLSPLVP IREVVFLRFC  480
KQHAEGLWAV VDVSVDAVLR PDQNGGGGSS SSSYMGCRLL PTGCIVQDMN NGYSKVTWVV  540
HAEYDETAAH QLYRPLLRSG QALGARRWLA SLQRQCQYLA ILCSNSLPAR DHAAITPVGR  600
RSMLKLAQRM TDNFCAGVCA SAAQKWRRLD EWRGEGGGGG GGGGGDGEDK VRMMARHSVG  660
APGEPPGVVL SATTSVRLPG TLPQRVFDYL RDEQRRGDWD ILANGEAMQE MDHIAKGQHH  720
GNAVSLLRPN ATSGNQNNML ILQETCTDSS GSLVVYAPVD VQSMHVVMNG GDSAYVSLLP  780
SGFAILPDGH NNGASPSLAE VGGGASPNSA AGGGGGSNNT GSLVTVAFQI LVNNLPTAKL  840
TVESVDTVSN LLSCTIQKIK SALQASIISP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1118123RKKKKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612621.10.0PREDICTED: homeobox-leucine zipper protein ROC6
SwissprotQ7Y0V70.0ROC6_ORYSJ; Homeobox-leucine zipper protein ROC6
TrEMBLA0A0E0B5J70.0A0A0E0B5J7_9ORYZ; Uncharacterized protein
STRINGLOC_Os09g35760.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein